PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn344231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 310aa    MW: 33282.8 Da    PI: 7.1232
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn344231genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.7e-383191262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg++k k+s+
  Achn344231 31 NHQALKCPRCDSINTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCQKAKRSK 91
                57899****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-252785IPR003851Zinc finger, Dof-type
PfamPF027016.7E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.053589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MQDIHAIGGG GGRLFSGGAD RRLRPHHQNQ NHQALKCPRC DSINTKFCYY NNYNLSQPRH  60
FCKSCRRYWT KGGVLRNVPV GGGCQKAKRS KAKSSAAATP RERKSNSNSS SESSSLTAST  120
NNNTTPSEAA MATADLASAS SSTSASTLFN FPDSSFFKFS QTTNGNFDPP PPPLIDPPSD  180
GGLFPEIGSF TSMMTSSNDP SLLGFNIGEI SASEYRLQQP NPDSVLQNPI LNQIACTVGQ  240
ELKMQAISSG GFLDHTAPID LSGMDDRVNH CVLGALDWQT SGDQGLFDLP GTVDPTYWSQ  300
TQWADGYLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281321e-54AB028132.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-8.
GenBankAK0610001e-54AK061000.1 Oryza sativa Japonica Group cDNA clone:006-203-F09, full insert sequence.
GenBankAK1008921e-54AK100892.1 Oryza sativa Japonica Group cDNA clone:J023130J11, full insert sequence.
GenBankAK1013211e-54AK101321.1 Oryza sativa Japonica Group cDNA clone:J033034E07, full insert sequence.
GenBankAP0052841e-54AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149581e-54AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-54CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankGQ1835321e-54GQ183532.1 Oryza sativa Japonica Group Dof-type zinc finger protein 05 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267092.12e-98PREDICTED: dof zinc finger protein DOF5.4
TrEMBLF6GTE98e-95F6GTE9_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g04850.t012e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-36OBF binding protein 4